PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00036.1_g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 261aa    MW: 29935.2 Da    PI: 9.2633
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00036.1_g00035.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.83e-51111342128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                              ppGfrFhPtdeelv  yL++k++++++ +  +i+e+d+y+++PwdLp +++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg
  Rsa1.0_00036.1_g00035.1  11 PPGFRFHPTDEELVLMYLCRKCASQPIAA-PIITELDLYRYDPWDLPDMASYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATG 95 
                              9*************************999.88***************7777899******************************** PP

                      NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               dk++ +   + vg+kk Lvfy+g+ p+gekt+W+mheyrl
  Rsa1.0_00036.1_g00035.1  96 ADKPIGR--PKPVGIKKALVFYSGKPPRGEKTNWIMHEYRL 134
                              *****98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-617160IPR003441NAC domain
PROSITE profilePS5100559.92710160IPR003441NAC domain
PfamPF023656.1E-2711134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MMKPGADLQF PPGFRFHPTD EELVLMYLCR KCASQPIAAP IITELDLYRY DPWDLPDMAS  60
YGEKEWYFFS PRDRKYPNGS RPNRAAGTGY WKATGADKPI GRPKPVGIKK ALVFYSGKPP  120
RGEKTNWIMH EYRLADVDRS VRKGNSLRLD DWVLCRIYNK KGVIEKKRRS EVENGHVTAP  180
VMINFNKPEM MRGGSSCSDQ QVVSPEFTCE AKTEPSRWSN ALEVPFNYID AIADNEIVSR  240
LFGGNQMWST LDPLVVRQRT F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-76616611174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2458860.0AY245886.1 Brassica napus NAC-domain protein 14 (NAC14) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013681349.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-113NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A0D3AR780.0A0A0D3AR78_BRAOL; Uncharacterized protein
TrEMBLM4CVR20.0M4CVR2_BRARP; Uncharacterized protein
TrEMBLQ7Y1A50.0Q7Y1A5_BRANA; BnaA02g18390D protein
STRINGBra008309.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-153NAC domain containing protein 32